DPCstruct | MC343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 232 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S6VUS1 | 301-538 | GNVAVHQHSPALLQNIFKQIEKYRFNVSDTIPRHRKLDIYRKPLQQEISQFLNLLEFVDCGFAHRLSGPDFTHGAGMDLLFEEWRYA… |
| A0A2X4Z5U1 | 1-250 | MDALAGAGFGKLAQGTPLPPLPQDVDRELARVGIAVPANLNINRYTPEGLAKSQVLHRLAILDIPGFQQQTGSAVTLSGDGEERWRL… |
| A0A354PHK8 | 45-307 | None |
| A0A521U4N6 | 374-613 | None |
| A0A509EF06 | 53-275 | None |
| A0A377CE26 | 5-192 | None |
| A0A535E5U7 | 262-492 | None |
| A0A3M9YY13 | 2-235 | None |
| A0A1D8B1C7 | 16-256 | None |
| A0A4Q3X6P9 | 144-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.