DPCstruct | MC34295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 205 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1EES1 | 3-210 | SAYLITIFLSLMVASAELVTKFKDEPFAILTKNITAWFYILFNILIASISLYLLTKTGFFGNTEYDQIKAAFTAGFGSTILMRSKFF… |
| A0A850GI04 | 3-213 | IYSLLAFVLGISTALVELLSRYRDEPFKVIATSQFAWVYLLLNGFLAVAADAILVSSPYGDHDSAGGRAMLAVMGGLGAAVILRSRV… |
| A0A6P1QC45 | 2-164 | None |
| A0A6P0X6J3 | 2-198 | None |
| A0A2N8ZHH0 | 45-263 | None |
| A0A2S9XXX5 | 2-213 | None |
| Q2N9G6 | 54-254 | None |
| A0A1L3SXV9 | 25-240 | None |
| A0A4R5EPW8 | 2-217 | None |
| A0A561ULT5 | 8-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.