DPCstruct | MC34294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 151 ± 18 aa |
| Standard deviation of domain lengths | 18.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1DZI7 | 14-149 | SLGISPILAQDHEQGLDTVIGILDKAESRRPQDLKDIIIIVSEELGIDRENIQRQREETGFGYGQIFIANALAKETGKTFEEIVAEF… |
| A0A7W3V237 | 1-141 | MTGRRLLVLLMLLWPGVLLAEQTAQMSAAYQPDTGRKDIDAGLVDINYYVERHPDAFVDALHHQSGVARPQLQQWLQQPGRQAADLY… |
| A0A7C3VUH5 | 4-153 | None |
| A0A7Y3V4C4 | 5-147 | None |
| A0A1G4A4V3 | 10-162 | None |
| A0A7C4QT50 | 15-154 | None |
| A0A1G0AR86 | 1-175 | None |
| A0A2V6QIL8 | 1-185 | None |
| A0A3D1AJ39 | 1-131 | None |
| A0A3D5WYF6 | 14-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.