DPCstruct | MC34291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1080 |
|---|---|
| Mean domain length (aa) | 134 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 12.74 |
| Pfam Score | 82.06 |
| Assigned Pfam label(s) | PF12631- CL0113- CL0020- CL0263- PF14838 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U7GFD2 | 4-124 | LDELMQLPGAMAAFEFRGSGELLDHRIAYPDRINPATLDLVAHMCSANMSIATMQARGWEQVTAMKGFYPIQEFTLIGFDWSVVVSG… |
| A0A842R1L8 | 1-142 | MKDILNLMIIDRESGICIFEQDFEDLPNDADPELVGGFFTALMCFSNRIADQDIEFIQLEKIRFYFHTGDKLVLISATRNSVSLEYI… |
| A0A819QZI0 | 893-1031 | None |
| A0A336QTG4 | 6-114 | None |
| A0A182FFE2 | 371-504 | None |
| A0A182FFD8 | 716-876 | None |
| A0A534KUV5 | 184-313 | None |
| A0A317WTZ4 | 2-160 | None |
| A0A6I9K6L9 | 15-165 | None |
| A0A848WXM1 | 7-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.