DPCstruct | MC3429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831W7H7 | 11-89 | DRVREAEAIMDAGEAQYPQYFPSHETTRWFDPYLYRFYPETGIYLGINEDEKAVYLLGGVFGDRLYRVGSLAEVAALLG |
| A0A7Z0MPR4 | 3-74 | EIDLLFDWIEVNYPHYLPSHQESFYSGGYRTRHYPSTDGYIYVRDNYVYFSNNHYSFINFGPLDYWLDISGI |
| A0A6N1YFF2 | 164-245 | None |
| A0A1V4MSD0 | 75-144 | None |
| A0A1V4MDX8 | 159-234 | None |
| A0A482Z0G3 | 124-211 | None |
| A0A839IWL1 | 16-99 | None |
| A0A5C8CAW7 | 173-251 | None |
| A0A1I3HLQ7 | 18-91 | None |
| A0A7Y9FW27 | 617-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.