DPCstruct | MC34287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 302 ± 80 aa |
| Standard deviation of domain lengths | 79.67 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 69.57 |
| Assigned Pfam label(s) | CL0023- PF16897- PF02519- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842QSP5 | 28-348 | DVPGLLKDAWKGRGLGNRFLSAIGQADALIHVVDASGSIDEEGKITQPGSGNPVQDVMDIEMEIELWISHIIDRNKNQIKRDMNSVG… |
| A0A1G1Q9Y8 | 54-230 | IICEKEAKLDLVIQDLEVVENRLGRLEAGEEKDFSLRLKEILEKNKCLIEESFSEEEKKTLLNYNLVSIKPVFFVDKNENKGVQDII… |
| A0A5N5I9K4 | 42-304 | None |
| A0A2B4SHU7 | 691-974 | None |
| A0A4V5NIS2 | 2-295 | None |
| A0A6A6KT70 | 22-208 | None |
| A0A820YCK9 | 42-377 | None |
| A0A421JI74 | 1-261 | None |
| A0A146FT46 | 43-288 | None |
| A0A7C2L4E8 | 5-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.