DPCstruct | MC34285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 47 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0CZ96 | 32-75 | ETCAVCGERVYLPFHCEYCGKYYCDRHRLPFDHDCRNIGQWKNK |
| A0A842QNN9 | 2-47 | PSCQLCKRETETIFTCNYCGQKYCHEHRLPENHRCPGMPTSKEWRN |
| A0A1V4TU51 | 19-60 | None |
| A0A0F8Q9M1 | 1-49 | None |
| A0A842T9Q8 | 1-39 | None |
| H8I686 | 1-45 | None |
| O29080 | 1-50 | None |
| A0A2R6ERI7 | 1-56 | None |
| A0A7J3S2I9 | 45-100 | None |
| A0A4U7D6T6 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.