DPCstruct | MC34280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RC28 | 333-397 | EKMPCVAARGPDGKTVTGFLYRYTKEEVNIVCVCHGRSFSPAEFLRHAGSSETSQALRRIIVVSS |
| A0A251SCH6 | 76-137 | EKMPCVTTKVGKRIQGFLYRYGEDEEVRIVCVCHGSFLTPAEFVKHGGGGEVEHPLRHIVVT |
| A0A2K2DUD0 | 43-106 | None |
| A0A6A4PL59 | 75-148 | None |
| A0A3Q7EZT7 | 1-65 | None |
| A0A151TCH3 | 154-227 | None |
| I1H839 | 18-101 | None |
| A0A7J0ERX1 | 189-256 | None |
| A0A5N6PCU1 | 266-340 | None |
| A0A3B6G2D4 | 148-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.