DPCstruct | MC34279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SAM1 | 3-128 | TRLQNGTKLKKILQDSKDSVTESEIRNRMQPLTEQLMNTVNHLHTIFETHVFIAVCRGYWDRMGQDVLSFLENRKENKSVYKGSRVA… |
| A0A3L6RR18 | 296-413 | NTRLKRILEETREADGESDIRERMQAVRLQLSDSIQNLHEVFSSRIFVAICRGVWDRLGHIVLRFLESRKENRIWFRGSDYALRILD… |
| A0A2G3DJ11 | 23-121 | None |
| A0A453NLD1 | 69-190 | None |
| A0A2I0VRU8 | 1024-1146 | None |
| A0A7J0FG32 | 736-846 | None |
| A0A1E5W789 | 807-929 | None |
| A0A835TKY9 | 789-963 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.