DPCstruct | MC34278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 330 ± 26 aa |
| Standard deviation of domain lengths | 25.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817ILX9 | 7-342 | TELYSFVQQLSIVNNDEINEEYQSQSVALIHGHVNTEQIHISAEKLSAVEKAVKHKFGGSINFRKGNQIIKKARKRFHKNKHRIIRF… |
| A0A251RZJ3 | 30-369 | DIFTFLAEHISLLPTAWQKCVIVTEKPENRLVKVCMSQNYLLELLSQAANNLGENETLSKLMVSELLRMQFPSAGLTLLEDDFTVDL… |
| A0A817NRL8 | 215-536 | None |
| A0A060WMP1 | 7-330 | None |
| A0A816W939 | 562-924 | None |
| A0A817Z4J5 | 2-330 | None |
| A0A812JD92 | 4-314 | None |
| A0A816SMF0 | 192-534 | None |
| A0A835VHM8 | 423-705 | None |
| A0A821KHV5 | 306-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.