DPCstruct | MC34274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12174 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2LM72 | 9-93 | SGSGVFLGKAPTLSPSSTKTPRSPWMPFPMLFAAISNKVPRKDMALVTYHYGLFRAKKISRENFVKRLRLIVGDSLLRSTIMKLQ |
| A0A251RUK1 | 4-88 | HRMQKMARGQPPNAMNQPAGKKIPFELLLRVITPQLDKERAMQLRGLYVQLRSNKFNKEEFFRHLRSLVGDHMLKMAVYKLRQWQ |
| A0A2U1MBZ0 | 19-111 | None |
| A0A444X5Q9 | 242-338 | None |
| A0A2G5EFM8 | 107-192 | None |
| A0A2U1MC06 | 30-117 | None |
| A0A0K9QPZ5 | 179-262 | None |
| A0A6N2MJ52 | 159-246 | None |
| A0A2U1KFQ7 | 1-85 | None |
| A0A6J5XBN3 | 160-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.