DPCstruct | MC34273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 199 ± 40 aa |
| Standard deviation of domain lengths | 39.55 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 74.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3BZQ8 | 3-185 | CSVDDLEDIIGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAYLSYSLAAISVFGFIACCFVWFNNTAYPSEFMDPLDQKLLK… |
| A0A287I632 | 68-201 | VSVDDLEDIIGGHVWLGFICVFGGIWHILTTPFAWARRAFVWSGEAYLSYSLAALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQ… |
| A0A835J4H5 | 137-294 | None |
| A0A650G361 | 222-473 | None |
| A0A396I1Y2 | 94-274 | None |
| A0A7S0CKW5 | 131-377 | None |
| A0A2N9H999 | 441-670 | None |
| A0A823A6C2 | 299-536 | None |
| K0RJ67 | 163-409 | None |
| A0A1Y3BX75 | 237-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.