DPCstruct | MC34268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9K1P4 | 9-101 | SVQASSGASMPDVATPEAVDVEAVLRRLAARKGVTFNWQSSIIDLMKLLDLDSSLANRKELSNELGYSDAKDGSAEINIWLYKAVLR… |
| A0A5N7CMA5 | 6-85 | LNVLLANKAAQYAQPNMDWQNSVVDLLKILNLDSSREGRMRLAQRWNILIGEDGSASRNVALHRTITERLAANNGVIPDS |
| A0A1E4FGJ5 | 26-150 | None |
| A0A519KNH8 | 3-84 | None |
| A0A085EUS9 | 216-317 | None |
| A0A177Q7R3 | 105-202 | None |
| A0A7X0MN20 | 422-517 | None |
| A0A1R4FV95 | 3-92 | None |
| A0A357X3R4 | 95-185 | None |
| A0A270PK57 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.