DPCstruct | MC34264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 117 ± 28 aa |
| Standard deviation of domain lengths | 28.10 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 56.27 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | PF20252- PF12165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5C1D4 | 11-118 | SDALDIFIDFRAQRDNLCLFGLPTKEWEADPPRDHEALLELPQPVSGNNISRDGMLKRDWLSLVARHSDSWLLALAFFQGRNFIQSE… |
| A0A453M8I0 | 7-85 | FDSCDPDKENLCLYGHPDGTWEVSLPAEEVPPELPEPALGINFARNGMNRRDWLSLVAVHSDSWLLSVAFFFGAPLTAN |
| M1A1C8 | 15-162 | None |
| A0A1E5UMV1 | 27-156 | None |
| A0A287IJG7 | 9-106 | None |
| A0A1U8FFU1 | 49-118 | None |
| A0A2G3D0G7 | 13-118 | None |
| K8EDA7 | 2-108 | None |
| A0A6J0NZG1 | 22-107 | None |
| A0A1E5V4B6 | 14-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.