DPCstruct | MC34261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 241 ± 51 aa |
| Standard deviation of domain lengths | 51.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0685 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4YMY4 | 27-286 | PVVWMGRFLRRARAAWRGQTPRAQLIEGGLGWAAGVTLSAALGAACGRLPWWVQGVALKPLLARMALLRAGTEVAAALEAGNLPEAR… |
| A0A096CJI3 | 228-520 | APHPVRAVGVLIAALEKLLRRLFPKSPGGELAGGAALVALTIAIPTGLTALLLWGCGLLSPWLAFAAEALLCYQLLAAKSLRDESDK… |
| R5UX29 | 2-169 | None |
| A0A7X4DVU3 | 2-146 | None |
| A0A259NAZ5 | 29-295 | None |
| A0A7Y1TBD4 | 5-324 | None |
| A0A837TJQ7 | 78-370 | None |
| A0A2V8IH11 | 202-498 | None |
| A0A6N7A0R4 | 58-339 | None |
| A0A509EIN6 | 231-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.