DPCstruct | MC3426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 15.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662SXV7 | 2-138 | TTVYRDGDILLTRDKLIFTVLGYTHPPSRVIAALKYIPEELKHLFPGEYEGVRWRLAGTTMLRQVDALTPRGYLRSLSVLREHFPAY… |
| A0A7Z0MNS9 | 3-97 | IYQAKDFIQTREGLVFAVVEGGLEQGKVLCFLRYQWQGEAWKKLATDAANQLLEEQHPHYLFYSTVKSAHLHAVSVADITIHHQSKK… |
| A0A836R8S2 | 1-85 | None |
| X1AHY2 | 2-117 | None |
| A0A7J3ZQC2 | 2-95 | None |
| A0A841GH31 | 1-108 | None |
| A0A1Q6LG60 | 139-279 | None |
| A0A0U3DYF8 | 2-107 | None |
| A0A3R7AW15 | 8-131 | None |
| A0A661CG84 | 12-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.