DPCstruct | MC34258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 104 ± 27 aa |
| Standard deviation of domain lengths | 26.69 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6HII6 | 2-72 | IDAGAAGMVTVEVNNGVLTLVSVDQAEGWTYEVDKADATNIEVKFRNGTVEVEVEVEIENGMLKIKVKTET |
| A0A346Y164 | 218-292 | QATLDADEVGTVTIERTEDGVSLVDAVAVDDTWTVTVEDDEADEVHVRFRNGDTRVDLGAELEDGQVRVRVRTRQ |
| A0A366ZXU6 | 46-157 | None |
| A0A6N7GDC4 | 11-148 | None |
| A0A7K2FIH9 | 1-85 | None |
| A0A7V5C1H9 | 91-171 | None |
| A0A7K2J7V1 | 9-108 | None |
| A0A317KIG0 | 5-96 | None |
| A0A7C1UF04 | 184-276 | None |
| A0A7Y3MHB7 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.