DPCstruct | MC34257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 184 ± 33 aa |
| Standard deviation of domain lengths | 32.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6YQP8 | 16-200 | SFLKQNSVGSHRLMAQGNLPVSGYAMLVKVDSKIYEIHLAPSQGNYTVHSYFVGYKPISTQGDDAAFVDIPKKAAELDFLFTAELAG… |
| A0A854FD21 | 1-210 | MPNSLEAQIRQAMKTGSTLTIEFDQALNQKSPGTLNVFLHPANGGVRIDLDSGNQGEPAKILWLPWKQGELQTLQPGSISTVDMLFF… |
| A0A7G8BM77 | 128-320 | None |
| A0A423HNR1 | 220-444 | None |
| A0A2P2HLH1 | 5-125 | None |
| X6QFN5 | 319-501 | None |
| A0A542H390 | 36-271 | None |
| A0A7Y7TI04 | 32-192 | None |
| A0A2I2GMI3 | 74-275 | None |
| B6XGD5 | 319-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.