DPCstruct | MC34255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3X913 | 14-167 | LLFTYSAANAQDDIWEHTPSPYKVFKSGGSIFVPLEVMDREDLIGRDCGQYVIPHDAADDMLDWARTKNQDGSTCYDIQSIERAMGI… |
| A0A428CAR8 | 23-179 | KNKVDEILRISPNPDDGVFRPNPRKYLPKEYRQAHKELFDDGVAAFVKDDFFIQKFGNFGREDGAFVFPKDVAKAMIKEADGNPRKL… |
| A0A6G0ZYT5 | 262-433 | None |
| A0A017SUZ9 | 15-161 | None |
| A0A3R9MR60 | 348-509 | None |
| A0A7X9MG05 | 47-186 | None |
| D2QLI9 | 80-253 | None |
| A0A139RMT7 | 23-180 | None |
| A0A162Z574 | 523-671 | None |
| A0A1X1GTC7 | 36-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.