DPCstruct | MC34254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8BC45 | 2-104 | LPRIIGITGKYAEKNQLAASLGIAAEMPQDFDFDLKYKIVSFRLSATVGGFLQEKESNSSRFTDEQKKIVSNLRSGSQLAITDIKAV… |
| A0A1Q3WR22 | 18-165 | AGLNAQGIKKPDDGKKPAKKDTSSVPYIPVYLGHSDKRGGLISKSDFDMLLKQGISSRDSSGNEFNIVGFTFSYVQRNLYEDSVGRL… |
| A0A3C1R5K3 | 8-116 | None |
| A0A2T4WIW5 | 367-464 | None |
| A0A1W9SV00 | 13-115 | None |
| A0A2N5ZHV1 | 24-135 | None |
| A0A2N5YJH5 | 132-243 | None |
| A0A2S1QEW2 | 28-116 | None |
| A0A644TID6 | 142-249 | None |
| A0A090X5R3 | 81-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.