DPCstruct | MC34252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5ATS7 | 1-89 | MHIDNEDALFDWLSDELSPITDADPNALAKYVLALVKKPDKGHDELKAFTNEQLNVFLTDHTAPFVDKVFEALTSKSYMPASTAPTS… |
| A0A1B0C108 | 1-97 | MLINNTEALKSWLVVVLEPLCDADSSALARYVLALLKKDKPEKELKRVMIEQLDVFLTEETKSFVERLFEAISTEEYLKLPPPATAT… |
| T1ED05 | 1-99 | None |
| A0A817JKX5 | 1-101 | None |
| A0A4U5M0T7 | 1-89 | None |
| A0A817TDJ4 | 1-101 | None |
| A0A817JWX0 | 1-101 | None |
| A0A7C8Q5K9 | 4-100 | None |
| A0A674N737 | 1-88 | None |
| A0A0M0J886 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.