DPCstruct | MC34251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 207 ± 29 aa |
| Standard deviation of domain lengths | 28.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815L246 | 33-225 | MGKSYMEKLTQPKFVAHTSVQHNRVRTIIDSQFPAVQEQIKELILALVDIEFMKEKILKDDIQRKSTIVSREENALKHFLSEQNIQI… |
| A0A815BLB2 | 1-204 | MSRGHMDHLKNSKFVAQTVAQHKRIRKILKGEVTATQDTVCAFIDALVKIEFGKVYTGDVGTHVNTDDDNLEYIARREEQALKKILP… |
| A0A815BY63 | 404-638 | None |
| A0A817Q684 | 205-438 | None |
| A0A815T1B3 | 318-535 | None |
| A0A822CY19 | 55-249 | None |
| A0A433DHL0 | 7-173 | None |
| A0A821HF11 | 366-508 | None |
| A0A817NBF2 | 1-185 | None |
| A0A819BMR4 | 346-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.