DPCstruct | MC3425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2MNH3 | 1-103 | MDTVKLTAKEVPELYLEAEHITPDVFAGKSNQEIGDLSVHMGNQTYKLSDYFTVEGKAGAIAAETKIVIAGDVSKVKYIGMKMTAGE… |
| A0A7Z0MNP8 | 1-96 | MSALTFSAKHETAQRVDMSPLVCQLLKELSLADIAAIELQNGKRKIRVDELFDISGEDSQDIIINNSYAKLDFIGKELASGRMTVQG… |
| A0A101E350 | 1-78 | None |
| A0A7K4I8U2 | 1-86 | None |
| A6UT54 | 1-110 | None |
| A0A3D4XQ93 | 1-94 | None |
| A0A7J4FXH1 | 1-102 | None |
| A0A1V5IN74 | 334-425 | None |
| A0A7C2Z1R5 | 7-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.