DPCstruct | MC34249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1706 |
|---|---|
| Mean domain length (aa) | 190 ± 31 aa |
| Standard deviation of domain lengths | 30.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 12.78 |
| Pfam Score | 96.23 |
| Assigned Pfam label(s) | PF09328- CL0125- CL0101- PF08246- PF16169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3S904 | 24-216 | KGVCEEKVQDVVPENGTTILLQVPDVRQCTNYSCGAACFQAVMSYWGGEDQGEGQLIELLNTTLGETPHKGTYPDNMVKGAEKMGFR… |
| A0A2V9SQD9 | 27-225 | GPTPPNVLYKPNKLSFWLNNQYGDCVTAEEAFAKACHKPEIFISDTEVKKWAKQHKVLNGANLVDVLDAMMSKGFAQDGRTYDDGPY… |
| A0A7Y5SGY9 | 256-461 | None |
| A0A3D3LD43 | 397-628 | None |
| A0A6L3F270 | 250-453 | None |
| A0A2G2R395 | 72-281 | None |
| A0A0C1JCY0 | 13-178 | None |
| A0A5Q2RLK1 | 655-831 | None |
| A0A6L7ABI5 | 305-472 | None |
| A0A0P1B5U9 | 127-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.