DPCstruct | MC34244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.28 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 64.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1LA69 | 164-230 | FMPTDGTDVKVYAVGPDYAHAEARKSPALDGKVDRDSDGKEIRYPVILSSREKLIARKIVWAFRQTV |
| A0A6J1TJB7 | 6-70 | TDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEIRYPVILTNAEKLISRRVCLAFKQTVCGFD |
| A0A023B3C9 | 185-251 | None |
| A0A444TD43 | 68-134 | None |
| Q5RDF1 | 250-316 | None |
| F0YDM4 | 200-266 | None |
| A0A0V1ELC2 | 342-408 | None |
| A0A453FNX1 | 43-108 | None |
| A0A7S1FV16 | 95-161 | None |
| A0A833YCV9 | 216-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.