DPCstruct | MC3424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.02 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0021- PF11898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DTQ2 | 240-333 | MAFEMVETSKLFARTVAKIDPQWIEPQAQHLVKRSYSEPHWEMKRAQVVAFEQVTLFGLPIVARRRVHYGPIAPQESRELFIRRALV… |
| A0A7Z0MMV8 | 1-94 | MAAELVETPSLWPVWQNEVPMDEAFVRHLVKKNHFDPHWEKKAGRGAIFERTLLFGITLQSRRKIPYEHVDAKAARQMFIRQALVEH… |
| E2PIK4 | 296-381 | None |
| A0A2X3ILX2 | 1-107 | None |
| A0A1S2WVC4 | 299-381 | None |
| A0A0B8PCX4 | 331-416 | None |
| A0A848QB20 | 61-140 | None |
| A0A2J6NE69 | 138-220 | None |
| A0A087BPX2 | 1-92 | None |
| A0A4P8KZM5 | 128-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.