DPCstruct | MC34234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 70.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2ZWZ1 | 1-78 | MTHATSDGVLVDPASEKLFHRVATRIEERETQLTQQSPDGLPVTLTTEEADRIFEEVAPKKKEQTVGIGSVNEVARAT |
| A0A0D3E0I3 | 34-109 | THKNKAGVFVDGKSEQIYNDVVVRVEDRQTQLTQQSTDGLPVTLSTLEVDKIYEEVVPKKKGRTLGIGSVNDVPRA |
| A0A0D3A019 | 1-64 | None |
| A0A0D3DLW7 | 173-259 | None |
| A0A0D3CJK8 | 1-72 | None |
| A0A0D2ZZM3 | 1-88 | None |
| A0A0D3A9D5 | 51-137 | None |
| A0A0D3E6Z1 | 120-190 | None |
| A0A0D3AX82 | 8-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.