DPCstruct | MC34233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6IQM5 | 7-88 | ALTKSRGMQGKDILDPKIDLTQSWKICNYVATAFRQPIPINAVGVGSNAFAHESGIHADGMLKDRSNYELYSPDELGISESE |
| A0A0D2ZWP9 | 1-80 | MSLKRRGSHVMDGVYTRIDIRQILATSNMVQEYTGLYIQPHKPIVGANCIIHESGIHQDGMLKNWSAYGVLSPEDVEVVK |
| A0A7V4QB12 | 15-92 | None |
| A0A3L6SWM4 | 652-729 | None |
| A0A3P6FEZ7 | 222-301 | None |
| A0A376TMM2 | 93-172 | None |
| A0A6P3ZFD5 | 1-98 | None |
| A0A7J0E4U9 | 118-213 | None |
| A0A1R3IXC0 | 816-904 | None |
| W9RCY5 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.