DPCstruct | MC34230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 68.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2ZVQ4 | 1-71 | MDNYGKQIHEWKKKWEIDKVPKSINNTIWTEFCAHWDKEETKETSSTNSTNHRSDRKGKGIFKHNLGAQSI |
| A0A0D3AE47 | 170-248 | YTKRINEWKQKFDVGEVPKHINPDVWRDLCGHWTKDETKSLSTINSQNRCSGRGGKGMFVHNLGATSLQTRALQLMKEN |
| A0A0D3AGG5 | 1-73 | None |
| Q2A9F7 | 94-175 | None |
| A0A0D3BJ87 | 50-119 | None |
| A0A0D3D544 | 92-169 | None |
| A0A0D3CQJ7 | 109-196 | None |
| A0A6J0NT91 | 159-228 | None |
| A0A0D3AGA1 | 14-88 | None |
| A0A0D3BHM5 | 40-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.