DPCstruct | MC3423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 173 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432S2Z2 | 22-190 | FSTNVDKFKEFLKKTNYSFYVILLGREDDHFIKNFMIKNWKNLHYMSGEKILFLSIYKPDKIDNEIKEDLKKKFGDLIDNTATFDPS… |
| A0A853PR68 | 21-184 | NVPNICGCIMYTVANPNIIKVLRDTDYWQCFDFISNKWPIFALKPKPELLLEYMVGVPMTNNNYKLFLDFFALKEEDIPCFILFAQI… |
| A0A501QA28 | 16-184 | None |
| A0A6L9ZM16 | 281-442 | None |
| R7BML3 | 5-178 | None |
| A0A143HHV9 | 84-261 | None |
| A0A7X0SC62 | 35-183 | None |
| A0A2H0QJH7 | 6-167 | None |
| A0A0E3NVS3 | 3-177 | None |
| A0A2E6VFU8 | 2-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.