DPCstruct | MC34225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8SX90 | 578-650 | VIYASVPGPEAIRIAVEAGVGATVTVTAGAEIDNLHAGPITMTGRVHSIKHGDKDAVTEVVLQVGSVFAIVTK |
| A0A1V2SAH4 | 1-98 | MLDASLTDSCFGYIYDTEVANKAHQAGVGANIQVRLGGKTDHLHGKPLEINAYVKTLTDSVFYQSSPMWKGMKNNLGKSARLVVEGL… |
| R8BHQ3 | 690-762 | None |
| A0A4P5SSF6 | 331-431 | None |
| A0A7S2CYI1 | 30-128 | None |
| N9QFN0 | 215-314 | None |
| A0A4V2D886 | 88-187 | None |
| A0A4R9EU57 | 672-757 | None |
| A0A7J4FMN4 | 38-120 | None |
| A0A4R6QQ66 | 317-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.