DPCstruct | MC34224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C907 | 5-169 | GPVTNNKHLFLRIVDDVKTDSSYIYTAKSTFKGDTVGLKVEVVNLIPAGIIDDVANEDVGFTKGKIKISSLGAESDAFIKALGKIYE… |
| A0A4V1K1W6 | 3-176 | YKQINANTEEGFQDLEFSIEEYFQDENQNQIVRAIGLFEEETVGFEAVFKSDMVPGIKGNTIDNTAFCKGGVSLRSMGIVSDKFVQA… |
| A0A2T5R9Z4 | 315-480 | None |
| A0A1J5RLR8 | 23-204 | None |
| A0A5B8S4H3 | 1-187 | None |
| A0A7G9QFI6 | 18-193 | None |
| A0A5C7LA05 | 123-287 | None |
| A0A4R2VRH7 | 30-208 | None |
| A0A4Q3HA57 | 70-252 | None |
| A0A2A9KEW2 | 26-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.