DPCstruct | MC34223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 133 ± 26 aa |
| Standard deviation of domain lengths | 25.66 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9K411 | 20-131 | VLERITLEYPAAADPERAVGLRAYMKDVAPFLGMTSPVRRSLSRAVLAGVPRPDEPDCTAVALRCWRLPEREYHYFAVDYLRRYVTH… |
| A0A512B9F5 | 1-133 | MHPYNTFLAAELNEIKDAKKAVAMKAYLKNQFEFLGIPTPERREIFKIHLKQHVIKDSHDLVAIVKELWGLAEREFQYCGLETLLHY… |
| A0A7J9ZJQ1 | 11-159 | None |
| A0A0V0QJI8 | 66-229 | None |
| A0A534N2M1 | 4-146 | None |
| A0A0R1MKX5 | 2-108 | None |
| A0A0B8NX34 | 8-143 | None |
| A0A177WL45 | 76-252 | None |
| A0A7X2HLV7 | 16-166 | None |
| A0A2A4G8A9 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.