DPCstruct | MC3422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9Y9V3 | 39-183 | TTGNRATLEPVFTAADARLELSWPAGQSGVVVIVDAAALWLAAHSPAVEAAAAASWPQVTAVTLVTPGADPARVGLAARLAAHLTTV… |
| A0A1S1QK75 | 1-165 | MHVLIDIDGGPGFLDAVDLKPFPLSARPGVVLDRPGGAGPVFVASHPFPPESAARSLAAMRGERVLVCCPSPVSPALTRLALAVGRI… |
| A0A0Q1C1Z3 | 2-179 | None |
| I9AAH8 | 1-155 | None |
| A0A1V2I9B5 | 28-204 | None |
| A0A1S1S443 | 112-272 | None |
| A0A2I2KKB4 | 75-251 | None |
| A0A1S1QQX3 | 2-123 | None |
| D3D581 | 81-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.