DPCstruct | MC34214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 143 ± 27 aa |
| Standard deviation of domain lengths | 27.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2Z0T1 | 142-282 | PDVSDEALATRAKEWLAPHLHGLTKLTELRNLNAHEILSGLLDWPQRRRLDAELPDRLDLPNNRSAAIDYDRDPPTLEARAQHLFGL… |
| A0A2N8F4E2 | 1-84 | GSNHPIDYDAEGGPRVDLRPQALFGLATHPMIAGGRVPLVLSLTSPAGRPIQTTRDLPGFWAGSWAAVAKEMRGRYPRHPWPDD |
| H6SRG5 | 385-526 | None |
| A0A377CVP9 | 23-151 | None |
| A0A3M0A8K1 | 635-789 | None |
| A0A3P3U5L3 | 724-879 | None |
| A0A7S2S986 | 2-121 | None |
| A0A6J7ERN5 | 52-204 | None |
| A0A354FPC1 | 1-98 | None |
| A0A484WV00 | 11-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.