DPCstruct | MC34213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y6W7N4 | 1-97 | MSRHQLPLREGVEASSAWIGWDRPLLTFFAQVFVTDPADPGEEVELLWRGTSERELPRPIDAIRLLEPYCDIPAEIAVSLEVDRMKT… |
| A0A1Q2YWX3 | 1-94 | MSRHELPAKRPGTSVVVGWDNPMMTFFAQVLDEQAEEDADPVLLWLGTQHGEVTRPEDLVRPLAPFADLTAPHLEQLRADRVADLDC… |
| A0A1H0DSD5 | 432-508 | None |
| A0A1N5TX43 | 1-89 | None |
| A0A1R0KVQ5 | 10-96 | None |
| A0A543JWH9 | 1-86 | None |
| A0A7X0U5S6 | 103-199 | None |
| A0A1H6CUB4 | 22-96 | None |
| W0FTR6 | 107-196 | None |
| A0A0Q4U261 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.