DPCstruct | MC34211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 162 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9I1I9 | 123-263 | SEETLVGAQLHGFPLFIHNNLKLKNAALNAASPILRLTRAGETVWGPLPGGDWTVFSSNDSTYEPLSWATHIGEDLTMSEELKKPLS… |
| T1JLN2 | 61-225 | KEESLVGAQVKGFPLFIHTNLSLKDCRLNPLSPILRLTRAGEIATGQLPAGDWTVFHSEHETYSPLATASALTTESLEDSSKIPPQL… |
| A0A5N3VAZ9 | 167-349 | None |
| H2YCB2 | 76-246 | None |
| S4RCH5 | 95-264 | None |
| A0A498P5E9 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.