DPCstruct | MC3421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19655 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540WH63 | 1-74 | MSAERLLHELEQLHRTRHETFLYGSDDALRRHTERTTELEAEYLRRFPVRMVTASRTRSGARARETAARIEATP |
| A0A3N4ZVV1 | 12-84 | TGVDPSRLDDQQLMKELETIHRTRHDTLLYASTDALRAHNDRMAQLEGEYLRRNPQRMVAAGRTREGARDRRC |
| A0A1Q4E0H8 | 1-83 | None |
| A0A239PDX1 | 5-75 | None |
| A0A7Y6GBZ3 | 1-73 | None |
| A0A2P2BWG3 | 1-72 | None |
| A0A838H3K1 | 6-79 | None |
| A0A5P2CPL6 | 3-74 | None |
| A0A542HX93 | 12-84 | None |
| A0A3N1AP98 | 50-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.