DPCstruct | MC34209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2BJZ1 | 165-262 | FDDLGHIIFPEQILGSSDHRGFLFVRPTFQCLSKLTVPNTPYLVAILIHKWEVPWAKVFPLRLMLRMGAECRYYPCALVSVRHRKPV… |
| A0A444TGK5 | 996-1098 | GNIVTELGHTIFTEPEGFLGSKDHGGFLYVRPTYQCLHKLLLPPAPYIFAVLIQKWETPWAKVFPLRLMLRLGAEFRYYPCPLVSTR… |
| A0A2I0TC31 | 105-227 | None |
| A0A4Z2B6E1 | 458-556 | None |
| A0A183QAU3 | 4-125 | None |
| A0A3Q0DJA4 | 219-316 | None |
| A0A183EKK5 | 166-283 | None |
| A0A5E4NKT9 | 825-915 | None |
| A0A4W5QSQ8 | 62-177 | None |
| T1K5V6 | 844-940 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.