DPCstruct | MC34208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 148 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4VS91 | 38-211 | RWNLYPNLNYAGLFYAIGNLLEVFPLITTGQTAIGEAVLDTLKALMMFLDRDTLEQLPLLLASNIGVLPNELDKQIVHLLADTVLPF… |
| A0A061A8U0 | 49-177 | PYTMISTLATFPPFLHKDIIEYLSTSFLPMAVLGSTRREGGVPAYVNLSASSMLMIAMQYTSNPVYHCQLLECLMKHKQEVWKDLLY… |
| A0A183M3U4 | 9-135 | None |
| A0A4U5N1K8 | 1-120 | None |
| A0A0P4WEN1 | 126-252 | None |
| A0A0P4W771 | 104-256 | None |
| A0A183U2A3 | 12-183 | None |
| A0A815HCB1 | 126-262 | None |
| E2BRI3 | 1-195 | None |
| A0A7J7XTP9 | 131-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.