DPCstruct | MC34207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 127 ± 24 aa |
| Standard deviation of domain lengths | 24.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.58 |
| Pfam Score | 75.62 |
| Assigned Pfam label(s) | CL0630- CL0159- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061A7D7 | 10-145 | VTLSRFLVIRTGLDHGVSLSSDNVLSLFLVIEQGKVLKVLHTIEDAFIISQYSLFHNEGPVLSMAIDSKKGHLYVGTAMEVQRIPLA… |
| A0A7J7EVH9 | 56-171 | ILQPLKTTPVFRAPGLSSVAVASVGNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMA… |
| B7Z9A5 | 67-188 | None |
| A0A1S3PW25 | 87-239 | None |
| A0A834Y1X5 | 399-527 | None |
| A0A2G8L096 | 327-448 | None |
| A0A6I9YV60 | 2-113 | None |
| A0A6I9YW78 | 5-108 | None |
| A0A452T624 | 442-573 | None |
| A0A7R8XFK1 | 812-931 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.