DPCstruct | MC34204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 106 ± 24 aa |
| Standard deviation of domain lengths | 24.42 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 96.80 |
| Assigned Pfam label(s) | CL0661- CL0004- CL0041- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061A1K9 | 11-102 | WLQIEPLTSTVQGVTMFRHRTPKGSYECTVSGLRWLCERDVILKYHFRNWEPYSQLLKDMQYTQGGPLLDITMELGELEEVHLPHFV… |
| A0A1S3QFD7 | 1-75 | MFRHRTPKGSYECTVSGLRWLCERDVILKYHFRNWEPYSHLLKDMQYTQGGPLLDITMELGELEEVHLPHCVCLG |
| A0A5A9NP91 | 3-77 | None |
| W5LWM0 | 2-86 | None |
| A0A671TYR4 | 76-177 | None |
| A0A7J6CVI9 | 2-102 | None |
| A0A2D0QJ05 | 105-211 | None |
| A0A673W016 | 641-732 | None |
| A0A1S3Q403 | 493-614 | None |
| A0A5J5CFP7 | 82-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.