DPCstruct | MC34203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 162 ± 32 aa |
| Standard deviation of domain lengths | 32.43 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 57.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437BYE0 | 149-328 | DRRPCTLQQLISDTMVRWAQESVIEDPDLVRAMFVLLHRQYDGIGGQVRALPKTYTINSVSVEDTVNLLAALGQIRSLLSVRMGKEE… |
| A0A060ZQZ6 | 1-157 | MASWAQECSIQDPELVRVMFSLLRRQYDGIGALLRAMRKSYTISAVSVQDCVNLLASLGQIRSLLSVRMGKEEEKLMIDGLGDIMNN… |
| A0A815S657 | 52-256 | None |
| A0A6J0XIR1 | 480-662 | None |
| H3CEU6 | 2-163 | None |
| A0A4Z2JB79 | 21-192 | None |
| A0A3L7I0J8 | 401-519 | None |
| A0A194RJU7 | 174-373 | None |
| T1GUW0 | 50-252 | None |
| A0A819YXF2 | 385-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.