DPCstruct | MC34202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060ZH63 | 5-139 | VAVTAPQQAPVVMAPQAQVQAGAQAASQPALPQQTSAPVAPGASVISQEMQENVKKCKNFLATLIKLASHNSPSPETSKNVKSLVQD… |
| A0A822A7M0 | 1-143 | PVTMSGMQQQPSVIPFQLNQQSDTCQIHTTTFTQSQIDSFTSKCRFFLLTLLRLTEKQAPEKLPIVRSCVQDLLNGTIDPETFAQRL… |
| A0A6A1QFX8 | 1-112 | None |
| G1L0A3 | 34-153 | None |
| A0A6J3IC51 | 131-240 | None |
| A0A3L8S570 | 93-244 | None |
| A0A3Q1EZ17 | 25-151 | None |
| K7F3R2 | 97-232 | None |
| A0A673WET8 | 1-170 | None |
| A0A2I3MC54 | 19-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.