DPCstruct | MC3420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 96 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0441- PF03691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4ZVJ2 | 138-233 | VLPHFPYHPNPVATGSVTASDEACACCRQERGWVYTGPVYAADAPDTGICPYCIAFGTADARYDASFTDTIDGDVPQHVITAVLKRT… |
| A0A2U1AIA1 | 57-142 | PLFRYNPHAEKLGIIKKENTKCPVCEQEREYVYQGPFYSEDQVEGICPWCIKDGSAAKKYDGEFQDAASCEDVEKEEYLVELTTRT |
| A0A4R2BIN3 | 3-114 | None |
| A0A6G2VSS8 | 3-94 | None |
| A0A3R6T9T6 | 1-108 | None |
| A0A2D6RE28 | 5-105 | None |
| A0A3N9XTW9 | 1-106 | None |
| A0A7J5BZQ4 | 191-295 | None |
| H1PM10 | 58-155 | None |
| A0A418MGU5 | 204-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.