DPCstruct | MC342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1I3W8 | 1-100 | LPLRLTGEAKLGEMILYAALSAQLSGPLISPQLAFHPGALLRSRGRVIDALNIDEIRWPLAGVKVTQQGVDGRLQAILRAHEQQMGD… |
| A0A2X4YS27 | 1-124 | MLNIGPGKLSMDSSDMPLQLTGEAKLGDLIFYARLPAQLSGPLIAPVLNFHPGALLRSRGRVIDSLNIDEIRWPLAGVTVTQQGVDG… |
| A0A4Q1B5P7 | 175-307 | None |
| A0A376YHW8 | 67-196 | None |
| K8AZU6 | 1-121 | None |
| A0A376ZS22 | 302-436 | None |
| A0A377E480 | 78-184 | None |
| A0A381H2V2 | 80-211 | None |
| A0A7D6DJ38 | 316-416 | None |
| A0A448QMP4 | 7-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.