DPCstruct | MC34199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10185 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7E7S6 | 7-58 | LSTFTIDDNRAIFMFADGSKAWEGKDFLLKQPQVSEVSLEGRQYPGLAFRKK |
| A0A3B5K064 | 207-264 | FDIQRFVVGSNRVIFMLRDGSVAWEVKDFLVSQERCVDVTVEGQVFPGKAAQKDDAKK |
| A0A7J7J594 | 32-91 | None |
| A0A0M3IFA5 | 65-115 | None |
| A0A7R8H9D4 | 337-399 | None |
| A0A671SP89 | 73-133 | None |
| G1Q025 | 76-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.