DPCstruct | MC34196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060ZAR6 | 1-88 | MNSLEFCNAVIQVAHPLVRRQLVDYVHNGFLVPVMGPALHKSSVDEMIASTTYLDLFLRSITETSLLKTFLRFILMHRHDNDTILDTL |
| A0A1S3QMJ6 | 172-257 | NSLQFCCSVIKAGHPSIRGQLLRYIYNGFLVPVLAPALHKCTLEEVMTTTAYLDLFLRSVSEPNLLQTFLSFILLHTHDNVQLLDT |
| A0A183R6F1 | 162-246 | None |
| A0A6I8SLV6 | 65-160 | None |
| A0A816WDR7 | 1-88 | None |
| A0A4Z2BP88 | 283-373 | None |
| A0A816T6B1 | 46-126 | None |
| A0A3M6T7Y4 | 292-382 | None |
| A0A812EE01 | 101-198 | None |
| A0A662YWG4 | 86-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.