DPCstruct | MC3419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378B0J9 | 194-335 | HYVGQEKLRPQTGWQPLAFALDWQRPARHMNSTSYFYNHSSQWRYETVTAQELLSPMADKSRYSGHLIDFNVRAERMGWLPSAPQLG… |
| A0A376KUC0 | 162-292 | HYVGQEKLRPQTGWLPLAFALDWNRPPRQMNSTSFFYNHSSQWRYEKVSAQELLSPLADASKYSGHLIDFNVRAERMGWLPSAPQLG… |
| X7YBV1 | 516-661 | None |
| A0A2X3CFL2 | 194-289 | None |
| A0A3S4H1M3 | 126-260 | None |
| A0A7G1I7E4 | 338-482 | None |
| A0A378F4Z1 | 126-245 | None |
| A0A377CWI7 | 40-144 | None |
| A0A017HEE1 | 124-243 | None |
| A0A0D1IB09 | 348-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.