DPCstruct | MC34189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 166 ± 22 aa |
| Standard deviation of domain lengths | 21.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 63.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7FRZ4 | 1-151 | MEFPSPHLLVDVSDGTTPNTLPGKTMFKPVRPYGSNFECADNTMDSIHDTRTKEGVWSPDIEESFFEALTVYPPCGRRKIILSEEHK… |
| A0A0R3W6I9 | 1-131 | MQPPASSGSRLPPPGQSNPSARVPLSSSTSAHSDGVWSTEIEQYFQEALELYPPCGRRKIILAEEGKMYGRNELIARYIQQRTGKVR… |
| A0A1G4JU98 | 42-213 | None |
| A0A058ZBM4 | 1-145 | None |
| A0A158PL37 | 1-183 | None |
| A0A6J8AIB1 | 1-194 | None |
| Q32KE5 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.